Advanced Search



Anti-TBX21 antibody produced in rabbit

SIGMA/AV32612 - affinity isolated antibody

Synonym: Anti-HGNC:11599; Anti-T-PET; Anti-T-bet; Anti-T-box Transcription factor; Anti-TBLYM

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32612-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Anti-TBX21: Cat. No. AV32612: Immunohistochemistry of TBX21 in Human Skeletal Muscle tissue with TBX21 antibody at 4-8 μg/mL.
Immunohistochemistry Anti-TBX21: Cat. No. AV32612: Immunohistochemistry of TBX21 in Human Skeletal Muscle tissue with TBX21 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: liver (Cat. No. AV32612). Lanes 1. Antibody dilution (concentration) 1.0-2.0 μg/mL in cell type liver

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 58 kDa
NCBI accession no. NP_037483 
Quality Level 100 
shipped in wet ice
species reactivity pig, dog, bovine, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9UL17 
Application: Rabbit Anti-TBX21 antibody can be used for western blot applications at a concentration of 1.0-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Application: Rabbit polyclonal anti-TBX21 antibody is used to tag T-box 21 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of T-box transcription factor 21 in the differentiation of interferon-gamma (IFNG) producting CD4 T helper 1 (Th1) cells.
Biochem/physiol Actions: TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Rabbit polyclonal anti-TBX21 antibody reacts with canine, bovine, pig, human, mouse, and rat T-box transcription factor 21 transcription factors.
General description: T-box genes encode transcription factors that regulate developmental processes. T-box transcription factor 21 (TBX21) is the human ortholog of mouse Tbx21/Tbet, a lineage commitment regulator for the differentiation of interferon-gamma (IFNG) producting CD4 T helper (Th1) 1 cells.
General description: TBX21 is involved in the development of T-lymphocytes. Functional TBX21 variations have been associated with aspirin-induced asthmaand have been linked to clinical outcomes for inhaled corticosteroid therapy in asthma patients.
Immunogen: Synthetic peptide directed towards the middle region of human TBX21
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top