Advanced Search



Anti-TRIM10 antibody produced in rabbit

SIGMA/AV34424 - IgG fraction of antiserum

Synonym: Anti-Tripartite motif-containing 10

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV34424-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV34424). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type HepG2
Western Blotting Western Blot of TRIM10 in Human HepG2 with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human Jurkat with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human MCF7 with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human 721_B with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human HeLa with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human Fetal Brain with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human Fetal Heart with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human Fetal Lung with TRIM10 antibody at 1 μg/mL
Western Blotting Western Blot of TRIM10 in Human Fetal Kidney with TRIM10 antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 55 kDa
NCBI accession no. NP_006769 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q9UDY6 
Application: Rabbit Anti-TRIM10 antibody can be used for western blot applications at a concentration of 5 μg/ml.
Biochem/physiol Actions: TRIM10 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein localizes to cytoplasmic bodies. Studies in mice suggest that this protein plays a role in terminal differentiation of erythroid cells.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: TRIM10 is a tripartite motif-containing protein that localizes in the cytoplasm. It has also been implicated in the differentiation and survival of erythroid cells.
Rabbit Anti-TRIM10 antibody recognizes human, mouse, bovine, and pig TRIM10.
Immunogen: Synthetic peptide directed towards the C terminal region of human TRIM10
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLSS
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top