Anti-ABHD18 antibody produced in rabbit

SIGMA/HPA051676 - Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym: Anti-C4orf29; Anti-FLJ21106

Product Type: Chemical

Catalog Number	PKG Qty.	Price	Quantity


45-HPA051676-100UL	100 µL	$598.00 1/EAAdd To Favorites		Add To Favorites

Immunohistochemistry Immunohistochemical staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

antibody form	affinity isolated antibody
antibody product type	primary antibodies
biological source	rabbit
clone	polyclonal
conjugate	unconjugated
form	buffered aqueous glycerol solution
immunogen sequence	KPMPLIPCLSWSTASGVFTTTDSFKMGQEFVKHFTSSADKLTNLNLVSRTLNLDISNQVVSQKPADCHNSSKTSVSATSEGLLLQDTSKMKRFNQRLSTN
product line	Prestige Antibodies^® Powered by Atlas Antibodies
Quality Level	100
shipped in	wet ice
species reactivity	human
storage temp.	−20°C
target post-translational modification	unmodified
technique(s)	immunofluorescence: 0.25-2 μg/mL
	immunohistochemistry: 1:500-1:1000

Application:	All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Disclaimer:	Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Features and Benefits:	Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section. Every Prestige Antibody is tested in the following ways: • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues. • Protein array of 364 human recombinant protein fragments.
Immunogen:	abhydrolase domain containing 18
Legal Information:	Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Linkage:	Corresponding Antigen APREST84091
Physical form:	Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.