Advanced Search



Anti-ABHD14A antibody produced in rabbit

SIGMA/HPA056913 - Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody

Synonym: DKFZP564O243; DORZ1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-HPA056913-100UL 100 µL
$598.00
1/EAAdd To Favorites
Add To Favorites
Immunofluorescence Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence NYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: 0.25-2 μg/mL
UniProt accession no. Q9BUJ0 
Back to Top