Advanced Search



Monoclonal Anti-HNF1B antibody produced in mouse

SIGMA/AMAB90733 - Prestige Antibodies® Powered by Atlas Antibodies, clone CL0374, purified immunoglobulin, buffered aqueous glycerol solution

Synonym: Anti-HNF1beta; Anti-LFB3; Anti-MODY5; Anti-TCF2; Anti-VHNF1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AMAB90733-100UL 100 µL
$570.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human kidney and tonsil tissues using AMAB90733 antibody. Corresponding HNF1B RNA-seq data are presented for the same tissues.
Enhanced Validation-Orthogonal RNAseq Confirmation Western blot analysis in human cell lines Caco-2 and A-431 using Anti-HNF1B antibody. Corresponding HNF1B RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Immunohistochemistry Immunohistochemical staining of human kidney shows strong nuclear positivity in cells in tubules.
Immunohistochemistry Immunohistochemical staining of human colon shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human renal cancer shows strong nuclear positivity in tumor cells.
Immunohistochemistry Immunohistochemical staining of human colorectal cancer shows moderate nuclear positivity in tumor cells.
Immunohistochemistry Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunofluorescence Immunofluorescence staining in A549 cell line with Anti-HNF1B monoclonal antibody, showing spotty nuclear (without nucleoli) staining in green. Microtubule probes are visualized in red (where available).
Western Blotting Lane 1: Marker [kDa] Lane 2: Negative control (vector only transfected HEK293T lysate) Lane 3: HNF1B Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400162)

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone CL0374, monoclonal
conjugate unconjugated
enhanced validation orthogonal RNAseq
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH
isotype IgG1
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 1 μg/mL
  immunofluorescence: 2-10 μg/mL
  immunohistochemistry: 1:500- 1:1000
UniProt accession no. P35680 
Application: All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
Immunogen: HNF1 homeobox B
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Physical form: Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top