Advanced Search



Monoclonal Anti-LAMP1 antibody produced in mouse

SIGMA/AMAB91168 - Prestige Antibodies® Powered by Atlas Antibodies, clone CL3482, purified immunoglobulin, buffered aqueous glycerol solution

Synonym: Anti-CD107a

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AMAB91168-100UL 100 µL
$570.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemical staining of human kidney shows strong granular cytoplasmic immunoreactivity in renal glomerulus and tubules cells.
Immunohistochemistry Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry Immunohistochemical staining of human fallopian tube shows granular cytoplasmic immunoreactivity in epithelial cells.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.
Immunohistochemistry Immunohistochemical staining of human small intestine shows granular cytoplasmic immunoreactivity in glandular cells.
Immunohistochemistry Immunohistochemical staining of human skeletal muscle shows only very low cytoplasmic immunoreactivity.
Western Blotting Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line RT-4

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone CL3482, monoclonal
conjugate unconjugated
form buffered aqueous glycerol solution
immunogen sequence NFSAAFSVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDA
isotype IgG1
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoblotting: 1 μg/mL
  immunohistochemistry: 1:10000- 1:20000
UniProt accession no. P11279 
Application: All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Biochem/physiol Actions: The gene LAMP1 (lysosomal associated membrane protein 1) encodes a membrane glycoprotein that functions as an intracellular receptor. It is found to be expressed in the cytoplasm of several types of tumor cells and may be involved in tumor invasion. Lamp1 is crucial for perforin trafficking to the lytic granules and motility of these lytic granules. Its knockdown leads to inhibition of cytotoxicity of human natural killer cells.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
General description: The gene LAMP1 (lysosomal-associated membrane protein 1) encodes a type I transmembrane protein that has a short cytoplasmic tail containing a lysosome-targeting signal of GYQTI(382)-COOH. The gene is mapped to human chromosome 13q34.
Immunogen: lysosomal-associated membrane protein 1
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Linkage: Corresponding Antigen APREST93498
Physical form: Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top