Advanced Search



Monoclonal Anti-CDH2 antibody produced in mouse

SIGMA/AMAB91220 - Prestige Antibodies® Powered by Atlas Antibodies, clone CL3716, purified immunoglobulin, buffered aqueous glycerol solution

Synonym: Anti-CD325; Anti-CDHN; Anti-NCAD

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AMAB91220-100UL 100 µL
$573.00
1/EA
Add To Favorites
Enhanced Validation-Orthogonal RNAseq Confirmation Immunohistochemistry analysis in human heart muscle and skin tissues using AMAB91220 antibody. Corresponding CDH2 RNA-seq data are presented for the same tissues.
Enhanced Validation-RNAi Knockdown Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probes 1 and 2, using Anti-CDH2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry Immunohistochemical staining of human heart muscle shows strong positivity in the intercalated discs of cardiomyocytes.
Immunohistochemistry Immunohistochemical staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry Immunohistochemical staining of human testis shows strong membranous positivity in cells in seminiferous ducts.
Immunohistochemistry Immunohistochemical staining of human liver cancer (hepatocellular carcinoma) shows moderate to strong membranous positivity in tumor cells.
Immunohistochemistry Immunohistochemical staining of human skin shows no positivity in epidermal cells as expected.
Immunofluorescence Immunofluorescence staining of U-251 cells using the Anti-CDH2 monoclonal antibody, showing specific staining in the plasma membrane and cell junctions in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Western Blotting Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line U-251 MG
Prestige Antibodies® Highly characterized and Enhanced Validated antibodies

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone CL3716, monoclonal
concentration 1 mg/mL
conjugate unconjugated
enhanced validation orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation 
form buffered aqueous glycerol solution
immunogen sequence NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
isotype IgG1
pH range 7.2-7.4
product line Prestige Antibodies® Powered by Atlas Antibodies
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: 2-10 μg/mL
  immunofluorescence: 2-10 μg/mL (Fixation/Permeabilization: PFA/Triton X-100)
  immunohistochemistry: 1:500- 1:1000
  western blot: 1 μg/mL
UniProt accession no. P19022 
Application: All Prestige Antibodies® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project  . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols   and other useful information.
Features and Benefits: Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.
Immunogen: cadherin 2, type 1, N-cadherin (neuronal)
Legal Information: Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Physical form: Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Preparation Note: Upon arrival, mix gently and aliquot to avoid repeated freeze-thaw cycles
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top