Advanced Search



Anti-NR2F2 antibody produced in rabbit

SIGMA/AV100816 - affinity isolated antibody

Synonym: Anti-ARP1; Anti-COUP-TFII; Anti-COUPTFB; Anti-MGC117452; Anti-Nuclear receptor subfamily 2, group F, member 2; Anti-SVP40; Anti-TFCOUP2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV100816-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-NR2F2: Cat. No. AV100816: Immunohistochemistry of NR2F2 in Human Kidney tissue with NR2F2 antibody at 4-8 μg/mL.
Immunohistochemistry NR2F2 Antibody: Cat. No. AV100816: Immunohistochemistry analysis of NR2F2 in Human Lung with NR2F2 Antibody Antibody Concentration: 4.0-8.0 μg/mL. Cellular Data: Epithelial cells of renal tubule
Immunoblotting Cell Type: MCF7 (Cat. No. AV100816). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type MCF7
Immunoblotting NR2F2 Antibody: Cat. No. AV100816: Western Blot analysis of NR2F2 in Human Lung cell lysates with NR2F2 Antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 45 kDa
NCBI accession no. NP_066285 
Quality Level 100 
shipped in wet ice
species reactivity dog, pig, human, mouse, rabbit, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P24468 
Application: Anti-NR2F2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions: NR2F2 is an orphan nuclear receptor that plays an important role in metabolism and development. The crosstalk between NR2F2 and the transcription factor HNF4α is involved in regulation of insulin secretion and maintenance of glucose homeostasis. NR2F2 collaborates with OCT4 and miR-302 in differentiation of human embryonic stem cells and specification of neural ectoderm during development.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the N terminal region of human NR2F2
Other Notes: Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top