Advanced Search



Anti-GLIS2 antibody produced in rabbit

SIGMA/AV30037 - affinity isolated antibody

Synonym: Anti-GLIS family zinc finger 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV30037-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Anti-GLIS2: Cat. No. AV30037: Immunohistochemistry of GLIS2 in Human Bile Duct tissue with GLIS2 antibody at 10 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV30037). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type HepG2
Western Blotting Western Blot of GLIS2 in Human Ovary Tumor with GLIS2 antibody at 1 μg/mL
Western Blotting Western Blot of GLIS2 in Human 786-0 Whole Cell with GLIS2 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 56 kDa
NCBI accession no. NP_115964 
Quality Level 100 
shipped in wet ice
species reactivity dog, human, horse, bovine, rat, guinea pig
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9BZE0 
Application: Rabbit polyclonal anti-GLIS2 antibody is used to tag GLIS family zinc finger 2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GLIS family zinc finger 2 in kidney development and maintenance. Anti-GLIS2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions: Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: GLIS family zinc finger 2 (GLIS2), a Krüppel-like zinc finger protein family member with transactivation and repressor functions, is involved in kidney development, the maintenance of normal renal function and neurogenesis. Glis2 interacts with β-catenin and may function as a negative modulator of β-catenin/TCF-mediated transcription. Defective GLIS2 has been linked to the development of nephronophthisis.
General description: Rabbit polyclonal anti-GLIS2 antibody reacts with canine, human, chicken, rat, bovine, and mouse GLIS family zinc finger 2 transcription factors.
Immunogen: Synthetic peptide directed towards the N terminal region of human GLIS2
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top