Advanced Search



Anti-RAD17 antibody produced in rabbit

SIGMA/AV30206 - IgG fraction of antiserum

Synonym: Anti-CCYC; Anti-HRAD17; Anti-R24L; Anti-RAD17 homolog (S. pombe); Anti-RAD17Sp; Anti-Rad24

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV30206-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunoblotting Cell Type: Jurkat (Cat. No. AV30206). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type Jurkat
Western Blotting Western Blot of RAD17 in HeLa, HEK293T, Xenopus laevis egg extract, mouse embryonic with RAD17 antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 66 kDa
NCBI accession no. NP_579916 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. O75943-4  
Application: Rabbit Anti-RAD17 antibody can be used for western blot (1.25μg/ml) assays.
Biochem/physiol Actions: RAD17 is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation.The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity with DNA replication factor C (RFC), and can form a complex with RFCs. This protein binds to chromatin prior to DNA damage and is phosphorylated by ATR after the damage. This protein recruits the RAD1-RAD9-HUS1 checkpoint protein complex onto chromatin after DNA damage, which may be required for its phosphorylation. The phosphorylation of this protein is required for the DNA-damage-induced cell cycle G2 arrest, and is thought to be a critical early event during checkpoint signaling in DNA-damaged cells. Eight alternatively spliced transcript variants of this gene, which encode four distinct proteins, have been reported.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: RAD17 is a checkpoint protein that has been implicated in replication stress, checkpoint termination and genotoxic stress.
Rabbit Anti-RAD17 antibody recognizes bovine, canine, human, mouse, and rat RAD17.
Immunogen: Synthetic peptide directed towards the C terminal region of human RAD17
Other Notes: Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top