Advanced Search



Anti-E2F4 antibody produced in rabbit

SIGMA/AV31175 - affinity isolated antibody

Synonym: Anti-E2F transcription factor 4, p107/p130-binding

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31175-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-E2F4: Cat. No. AV31175: Immunohistochemistry of E2F4 in Human Stomach tissue with E2F4 antibody at 4-8 μg/mL.
Immunohistochemistry Anti-E2F4: Cat. No. AV31175: Immunohistochemistry of E2F4 in Human Stomach tissue with E2F4 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV31175). Lanes 1. Antibody dilution (concentration) 2.0 μg/mL in cell type HepG2

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 44 kDa
NCBI accession no. NP_001941 
Quality Level 100 
shipped in wet ice
species reactivity mouse, rabbit, guinea pig, rat, bovine, dog, human, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: 4-8 μg/mL (Paraffin-embedded Tissue)
  western blot: suitable
UniProt accession no. Q16254 
Application: Rabbit Anti-E2F4 antibody can be used for western blot (2.0μg/ml) and IHC (4-8μg/ml) applications.
Biochem/physiol Actions: The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins. It is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It also plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the C terminal region of human E2F4
Other Notes: Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top