Advanced Search



Anti-ISGF3G antibody produced in rabbit

SIGMA/AV31200 - affinity isolated antibody

Synonym: Anti-IRF-9; Anti-ISGF3; Anti-ISGF3G; Anti-p48

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31200-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-ISGF3G: Cat. No. AV31200: Immunohistochemistry of ISGF3G in Human Liver tissue with ISGF3G antibody at 4-8 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV31200). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type Jurkat

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 44 kDa
NCBI accession no. NP_006075 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, human, rat, bovine, mouse, guinea pig, dog, horse
storage temp. −20°C
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q00978 
Application: Rabbit Anti-ISGF3G antibody can be used for western blotting applications at 2.5μg/ml.
Application: Rabbit polyclonal anti-ISGF3G antibody is used to tag interferon regulatory factor 9/ISGF3 gamma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of interferon regulatory factor 9/ISGF3 gamma in the mediation of interferon-α and β (type I IFNs) signaling.
Biochem/physiol Actions: ISGF3G functions to recruit RNA polymerase II to the promoter of interferon-stimulated genes and requires histone deacetylases. Defects in ISGF3 can cause resistance to IFN-.(2a) treatment.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Interferon regulatory factor 9 (ISGF3G, IRF-9, p48) is a DNA-binding component of the heterotrimeric transcription factor ISGF3 which is activated by interferon-α and β (type I IFNs). The other two components of ISGF3 are STAT1 and STAT2. ISGF3 gamma or complexes containing ISGF3 gamma are involved in IRF-1-independent pathways mediating IFN gene regulation. ISGF3 plays a primary role in the transmission of a signal from the cell surface to the nucleus via regulatory factors p84/91 and p113.
General description: Rabbit polyclonal anti-ISGF3G antibody reacts with pig, bovine, human, mouse, rat, and zebrafish interferon regulatory factor 9/ISGF3 gamma proteins.
Immunogen: Synthetic peptide directed towards the N terminal region of human ISGF3G
Other Notes: Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top