Advanced Search



Anti-KLF9 antibody produced in rabbit

SIGMA/AV31369 - affinity isolated antibody

Synonym: Anti-Kruppel-like factor 9

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31369-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-KLF9: Cat. No. AV31369: Immunohistochemistry of KLF9 in Human Kidney tissue with KLF9 antibody at 4-8 μg/mL.
Immunohistochemistry Anti-KLF9: Cat. No. AV31369: Immunohistochemistry of KLF9 in Nucleus tissue with KLF9 antibody at 5.0 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV31369). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type Jurkat

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 27 kDa
NCBI accession no. NP_001197 
Quality Level 100 
shipped in wet ice
species reactivity rat, rabbit, horse, mouse, human, bovine, guinea pig
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q13886 
Application: Rabbit Anti-KLF9 antibody is suitable for use in western blot (1.0μg/ml) and IHC (4-8μg/ml) applications.
Biochem/physiol Actions: KLF9 is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Kruppel-like factor 9 (KLF9) is a transcription factor that regulates several functions such as central nervous systems (CNS) development, villus cell movement, intestinal cell proliferation, and PPARγ-mediated adipocyte differentiation. Furthermore, KLF9 also regulates the differentiation, adhesion and growth of endometrial cells and has been implicated in endometrial carcinoma.
Rabbit Anti-KLF9 antibody recognizes pig, bovine, human, mouse, and rat KLF9.
Immunogen: Synthetic peptide directed towards the N-terminal region of Human KLF9
Other Notes: Synthetic peptide located within the following region: LPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSDSLE
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top