Advanced Search



Anti-EN2 antibody produced in rabbit

SIGMA/AV31375 - affinity isolated antibody

Synonym: Anti-AUTS1; Anti-AUTS10; Anti-Engrailed homeobox 2

MDL Number: MFCD03096780
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31375-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-EN2: Cat. No. AV31375: Immunohistochemistry of EN2 in Human Kidney tissue with EN2 antibody at 4-8 μg/mL.
Immunohistochemistry Immunohistochemistry of EN2 in Human Kidney with EN2 antibody at 4-8 μg/mL
Immunoblotting Cell Type: fetal liver (Cat. No. AV31375). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type fetal liver
Western Blotting Western Blot of EN2 in Human Jurkat with EN2 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 34 kDa
NCBI accession no. NP_001418 
Quality Level 100 
shipped in wet ice
species reactivity dog, mouse, guinea pig, horse, human, rat
storage temp. −20°C
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P19622 
Application: Rabbit Anti-EN2 antibody is suitable for use in western blot (0.5μg/ml) assays.
Application: Rabbit polyclonal anti-ENS antibody is used to tag engrailed homeobox 2 transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of engrailed homeobox 2 transcription factor in brain development and skeletal muscle differentiation.
Biochem/physiol Actions: Homeobox-containing genes are thought to have a role in controlling development. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Engrailed homeodomain-containing transcription factors play crucial roles in brain development across many species, including the determination of the hindbrain/midbrain border, cerebellar patterning and aiding in neuronal axon guidance. Engrailed-2 (En-2) gene is expressed across the mesencephalon/metencephalon (mes/met) boundary in the cerebellar primordium. Engrailed-2 is involved in the determination of skeletal muscle physiologic properties. Urinary EN2 is a highly specific and sensitive candidate biomarker of prostate cancer.
General description: Rabbit polyclonal anti-ENS antibody reacts with chicken, zebrafish, human, mouse, and rat engrailed homeobox 2 transcription factors.
Immunogen: Synthetic peptide directed towards the C-terminal region of Human EN2
Other Notes: Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top