Advanced Search



Anti-MXI1 antibody produced in rabbit

SIGMA/AV31403 - affinity isolated antibody

Synonym: Anti-MAD2; Anti-MAX interactor 1; Anti-MGC43220; Anti-MXD2; Anti-MXI

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31403-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Anti-MXI1: Cat. No. AV31403: Immunohistochemistry of MXI1 in Human Lung tissue with MXI1 antibody at 4-8 μg/mL.
Immunohistochemistry Immunohistochemistry of MXI1 in Human Lung with MXI1 antibody at 4-8 μg/mL
Immunoblotting Cell Type: Jurkat (Cat. No. AV31403). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type Jurkat
Western Blotting Western Blot of MXI1 in Mouse Brain with MXI1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 26 kDa
NCBI accession no. NP_569157 
Quality Level 100 
shipped in wet ice
species reactivity rat, guinea pig, dog, bovine, human, mouse, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P50539  
Application: Rabbit Anti-MXI1 antibody can be used for western blot applications at 1μg/ml.
Biochem/physiol Actions: Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The MXI1 gene encodes a transcriptional repressor protein thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in MXI1 are frequently found in patients with prostate tumors.Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Max interactor 1 (MXI1) is a bHLH-Zip containing protein that associates with Max to bind Myc-Max recognition sites. MXI1 mutations have been linked to prostate cancer.
Rabbit Anti-MXI1 antibody recognizes human, mouse, rat, chicken, bovine, zebrafish, and canine MXI1.
Immunogen: Synthetic peptide directed towards the middle region of human MXI1
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top