Advanced Search



Anti-HOXB5 antibody produced in rabbit

SIGMA/AV31444 - affinity isolated antibody

Synonym: Anti-HHO.C10; Anti-HOX2; Anti-HOX2A; Anti-HU-1; Anti-Homeobox B5; Anti-Hox2.1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31444-100UL 100 µL
$541.00
1/EA
Add To Favorites
Immunohistochemistry Anti-HOXB5: Cat. No. AV31444: Immunohistochemistry of HOXB5 in Human Pancreas tissue with HOXB5 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV31444). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type HepG2
Western Blotting Western Blot of HOXB5 in Human Stomach Tumor with HOXB5 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 30 kDa
NCBI accession no. NP_002138 
Quality Level 100 
shipped in wet ice
species reactivity horse, mouse, bovine, rat, dog, guinea pig, rabbit, human
storage temp. −20°C
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P09067 
Application: Rabbit Anti-HOXB5 antibody can be used for western blot applications at 0.5μg/ml.
Biochem/physiol Actions: HOXB5 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: HOXB5 is known to regulate the development of gut neural crest cells in human embryos. It is also known to function as a transcriptional switch for vascular endothelial cell differentiation.
Rabbit Anti-HOXB5 antibody binds to canine, human, mouse, and rat HOXB5.
Immunogen: Synthetic peptide directed towards the N terminal region of human HOXB5
Other Notes: Synthetic peptide located within the following region: MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top