Advanced Search



Anti-OLIG2 (AB2) antibody produced in rabbit

SIGMA/AV31464 - affinity isolated antibody

Synonym: Anti-BHLHB1; Anti-OLIGO2; Anti-Oligodendrocyte lineage transcription factor 2; Anti-PRKCBP2; Anti-RACK17

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31464-100UL 100 µL
$541.00
1/EA
Add To Favorites
Immunohistochemistry Anti-OLIG2 (ab2): Cat. No. AV31464: Immunohistochemistry of OLIG2 in tissue with OLIG2 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: transfected 293T (Cat. No. AV31464). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type transfected 293T
Western Blotting Western Blot of OLIG2 in human LCL and mouse brains with OLIG2 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 32 kDa
NCBI accession no. NP_005797 
Quality Level 100 
shipped in wet ice
species reactivity rat, human, mouse, dog, guinea pig, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q13516 
Application: Rabbit Anti-OLIG2 (AB2) antibody is suitable for use in western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions: OLIG2 is a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. OLIG2 is an essential regulator of ventral neuroectodermal progenitor cell fate. It is associated with T-cell acute lymphoblastic leukemia due to a chromosomal translocation t(14;21)(q11.2;q22). OLIG2 might play a role in learning deficits associated with Down syndrome.This gene encodes a basic helix-loop-helix transcription factor which is expressed in oligodendroglial tumors of the brain. The protein is an essential regulator of ventral neuroectodermal progenitor cell fate. The gene is involved in a chromosomal translocation t(14;21)(q11.2;q22) associated with T-cell acute lymphoblastic leukemia. Its chromosomal location is within a region of chromosome 21 which has been suggested to play a role in learning deficits associated with Down syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: OLIG2 is a basic helix-loop-helix (bHLH) transcription factor that is expressed in the spinal cord. This transcription factor is involved in the development of oligodendrocytes and motor neurons. OLIG2 may be useful as a diagnostic marker of oligodendroglial cancer.
Rabbit Anti-OLIG2 (AB2) antibody recognizes chicken, human, mouse, rat, and bovine OLIG2.
Immunogen: Synthetic peptide directed towards the N terminal region of human OLIG2
Other Notes: Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top