Advanced Search



Anti-AHR (AB1) antibody produced in rabbit

SIGMA/AV31635 - IgG fraction of antiserum

Synonym: Anti-Aryl hydrocarbon receptor

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV31635-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemistry of AHR in Human Urinary Bladder with AHR antibody at 4-8 μg/mL
Immunoblotting Cell Type: placenta (Cat. No. AV31635). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type placenta
Western Blotting Western Blot of AHR in Human HepG2 with AHR antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 96 kDa
NCBI accession no. NP_001612 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, rat, mouse, human, dog, guinea pig
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P35869 
Application: Rabbit Anti-AHR (AB1) antibody can be used for western blot assays at a concentration of 2.5μg/ml.
Application: Rabbit polyclonal anti-AHR (AB1) antibody is used to tag aryl hydrocarbon receptor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of aryl hydrocarbon receptor in differentiation, cell development, and adaptive response to xenobiotic stress.
Biochem/physiol Actions: Aryl hydrocarbon receptor (AHR) is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. AHR ligands included a variety of aromatic hydrocarbons.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Aryl Hydrocarbon receptor (AHR) is a transcription factor with an undetermined physiological receptor. AHR binds exogenous ligands such as polycyclic aromatic hydrocarbons, plant flavonoids, polyphenolics and indoles. It also binds tryptophan derivatives, tetrapyrroles and arachiconic acid metabolites. Aryl Hydrocarbon receptor is believed to be involved in differentiation processes such as hematopoiesis and the development of lymphoid systems, T-cells, neurons and hepatocytes. AHR activation leads to the induction of a plethora of xenobiotic metabolizing enzymes.
General description: Rabbit polyclonal anti-AHR (AB1) antibody reacts with human, canine, mouse, rat, and rabbit aryl hydrocarbon receptors.
Immunogen: Synthetic peptide directed towards the N terminal region of human AHR
Other Notes: Synthetic peptide located within the following region: MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRL
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top