Advanced Search



Anti-ETV5 (AB1) antibody produced in rabbit

SIGMA/AV32264 - affinity isolated antibody

Synonym: Anti-Ets variant gene 5 (Ets-related molecule)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32264-100UL 100 µL
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunohistochemistry Anti-ETV5 (ab1): Cat. No. AV32264: Immunohistochemistry of ETV5 in Spleen tissue with ETV5 antibody at 5.0 μg/mL.
Immunoblotting Cell Type: 293T (Cat. No. AV32264). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type 293T

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 58 kDa
NCBI accession no. NP_004445 
shipped in wet ice
species reactivity rat, bovine, horse, guinea pig, mouse, rabbit, dog, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P41161  
Application: Rabbit Anti-ETV5 (AB1) antibody can be used for western blot applications at 1μg/ml.
Application: Rabbit polyclonal anti-ETV5 antibody is used to tag ETS variant gene 5 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of ETS variant gene 5 in spermatogonia maintenance and self-renewal.
Biochem/physiol Actions: ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: ETV5 loss has been linked to spermatogonial stem cell loss and infertility. Rabbit Anti-ETV5 (AB2) antibody recognizes human, mouse, rat, bovine, and canine ETV5.
General description: Rabbit polyclonal anti-ETV5 antibody reacts with human, mouse, rat, bovine, and canine ETS variant gene 5 transcription factors.
General description: Transcription factor ets variant gene 5 (ETV5/ERM) has various function in male reproduction. ETV5 regulates sertolic cell chemokines involved in stem/progenitor spermatogonia maintenance and is essential for spermatogonial stem cell (SSC) self-renewal.
Immunogen: Synthetic peptide directed towards the N terminal region of human ETV5
Other Notes: Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top