Advanced Search



Anti-FOXL1 antibody produced in rabbit

SIGMA/AV32303 - IgG fraction of antiserum

Synonym: Anti-Forkhead box L1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32303-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Anti-FOXL1: Cat. No. AV32303: Immunohistochemistry of FOXL1 in Human Muscle tissue with FOXL1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: liver (Cat. No. AV32303). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type liver
Western Blotting Western Blot of FOXL1 in Mouse Skeletal Muscle with FOXL1 antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 36 kDa
NCBI accession no. NP_005241 
Quality Level 100 
shipped in wet ice
species reactivity bovine, horse, human, pig, dog
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q12952 
Application: Rabbit Anti-FOXL1 antibody can be used for western blot (2.5μg/ml) and IHC (4-8μg/ml) assays.
Biochem/physiol Actions: FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The Forkhead Box L1 (FoxL1) is a transcription factor that modulates epithelial growth and gastrointestinal development. This transcription factor has been implicated in pancreatic and gastrointestinal carcinogenesis and can also function as prognostic biomarker for clear cell renal cell carcinoma. Studies in mce have also revealed that FoxL1 can function as a biological marker of the hepatic progenitor cells.
Rabbit Anti-FOXL1 antibody recognizes canine, human, and mouse FOXL1.
Immunogen: Synthetic peptide directed towards the N terminal region of human FOXL1
Other Notes: Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top