Advanced Search



Anti-TAF1 antibody produced in rabbit

SIGMA/AV32473 - affinity isolated antibody

Synonym: Anti-BA2R; Anti-CCG1; Anti-CCGS; Anti-DYT3; Anti-KAT4; Anti-NSCL2; Anti-OF; Anti-TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250 kDa

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32473-100UL 100 µL
$493.00
1/EA
Add To Favorites
Immunohistochemistry Anti-TAF1: Cat. No. AV32473: Immunohistochemistry of TAF1 in Human Kidney tissue with TAF1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HeLa (Cat. No. AV32473). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type HeLa
Western Blotting Western Blot of TAF1 in Mouse Heart with TAF1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 215 kDa
NCBI accession no. NP_004597 
Quality Level 100 
shipped in wet ice
species reactivity bovine, dog, rat, pig, human, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) ChIP: suitable
  immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P21675-2 
Application: Rabbit Anti-TAF1 antibody has been used for western blotting applications at 0.5μg/ml.
Biochem/physiol Actions: Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. TAF1 encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme.Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. Two transcripts encoding different isoforms have been identified for this gene.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: TAF1 is a transcription factor that is associated with TATA-binding proteins. It interacts with GCN5 and HD1 and facilitates the histone acetylation needed for light-induced genetic responses.
Rabbit Anti-TAF1 antibody recognizes canine, human, mouse, and rat TAF1.
Immunogen: Synthetic peptide directed towards the C terminal region of human TAF1
Other Notes: Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top