Advanced Search



Anti-SPDEF (AB1) antibody produced in rabbit

SIGMA/AV32533 - affinity isolated antibody

Synonym: Spdef Antibody; Spdef Antibody - Anti-SPDEF (AB1) antibody produced in rabbit; Anti-PDEF; Anti-RP11-375E1__A.3; Anti-SAM pointed domain containing ets transcription factor; Anti-bA375E1.3

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32533-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunoblotting Cell Type: placenta (Cat. No. AV32533). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type placenta
Western Blotting Western Blot of SPDEF in Human HepG2 Whole Cell with SPDEF antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 37 kDa
NCBI accession no. NP_036523 
Quality Level 100 
shipped in wet ice
species reactivity bovine, rabbit, human, dog, guinea pig
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. O95238 
Application: Rabbit Anti-SPDEF (AB1) antibody can be used for western blot applications at a concentration of 1μg/ml.
Application: Rabbit polyclonal anti-SPDEF (AB1) antibody is used to tag SAM pointed domain containing ets transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of SAM pointed domain containing ets transcription factor in the differentiation of Paneth and goblet cells and mucin production.
Biochem/physiol Actions: PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Rabbit polyclonal anti-SPDEF (AB1) antibody reacts with human, mouse, rat, bovine, pig, and canine SAM pointed domain containing ets transcription factors.
General description: SAM pointed domain containing ets transcription factor (SPDEF, PDEF) is involved in the regulation of terminal differentiation of goblet/Paneth progenitor cells into intestinal Paneth and goblet cells. SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6.
General description: SPDEF suppresses the metastasis of prostate cancer and modulates goblet cell hyperplasia in airway epithelial cells.
Rabbit Anti-SPDEF (AB1) antibody recognizes human, mouse, rat, bovine, pig, and canine SPDEF.
Immunogen: Synthetic peptide directed towards the middle region of human SPDEF
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top