Advanced Search



Anti-CCRN4L antibody produced in rabbit

SIGMA/AV32536 - IgG fraction of antiserum

Synonym: Anti-CCR4 carbon catabolite repression 4-like (S. cerevisiae)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32536-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunohistochemistry Anti-CCRN4L: Cat. No. AV32536: Immunohistochemistry of CCRN4L in Human Lung tissue with CCRN4L antibody at 4-8 μg/mL.
Immunohistochemistry CCRN4L Antibody: Cat. No. AV32536: Immunohistochemistry analysis of CCRN4L in Human Lung with CCRN4L Antibody Antibody Concentration: 4.0-8.0 μg/mL. Cellular Data: bronchiole epithelium of renal tubule
Immunoblotting Cell Type: Daudi (Cat. No. AV32536). Lanes 1. Antibody dilution (concentration) 1.0-2.0 μg/mL in cell type Daudi

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 48 kDa
NCBI accession no. NP_036250 
Quality Level 100 
shipped in wet ice
species reactivity human, horse, bovine, guinea pig
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9UK39 
Application: Rabbit Anti-CCRN4L antibody can be used for western blot applications at a concentration of 1-2μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.
Biochem/physiol Actions: CCRN4L is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: CCRN4L is a protein coding gene that is similar to a circadian clock gene, Nocturnin, and may be involved in regulating circadian functions.
Rabbit Anti-CCRN4L antibody recognizes bovine, rat, mouse, and human CCRN4L.
Immunogen: Synthetic peptide directed towards the N terminal region of human CCRN4L
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top