Advanced Search



Anti-HIPK2 antibody produced in rabbit

SIGMA/AV32586 - affinity isolated antibody

Synonym: Anti-Homeodomain interacting protein kinase 2; Anti-PRO0593

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32586-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Anti-HIPK2: Cat. No. AV32586: Immunohistochemistry of HIPK2 in Human Heart tissue with HIPK2 antibody at 4-8 μg/mL.
Immunohistochemistry HIPK2 Antibody: Cat. No. AV32586: Immunohistochemistry analysis of HIPK2 in Human Brain with HIPK2 Antibody Antibody Concentration: 4.0-8.0 μg/mL. Cellular Data: Epithelial cells of renal tubule
Immunoblotting Cell Type: HepG2 (Cat. No. AV32586). Lanes 1. Antibody dilution (concentration) 0.25 μg/mL in cell type HepG2

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 120 kDa
NCBI accession no. NP_073577 
Quality Level 100 
shipped in wet ice
species reactivity guinea pig, rat, dog, human, horse, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9H2X6 
Biochem/physiol Actions: HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the middle region of Human HIPK2
Sequence: Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top