Advanced Search



Anti-HOXB9 antibody produced in rabbit

SIGMA/AV32639 - affinity isolated antibody

Synonym: Anti-HGNC:5120; Anti-HOX-2.5; Anti-HOX2; Anti-HOX2E; Anti-Homeobox protein Hox-B9

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32639-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunofluorescence Formalin Fixed Paraffin Embedded (FFPE) human colon tissue section (A) was prepared using heat-induced epitope retrieval (HIER). 4% PFA-fixed, frozen proliferative colon intestinal organoid (Cat. No. SCC321, 3dGRO® Colon Intestinal Organoids, Age 21 (Prep 87-C)) (B) was treated with permeabilization buffer containing 1% goat serum and 0.3% Triton™ X-100. Immunostaining was performed using a 1:100 dilution of Cat. No. AV32639, Anti-HOXB9 Rabbit Polyclonal. Reactivity was detected using a Goat Anti-Rabbit IgG-ALEXA FLUOR™ 555 (Red). Nuclei were stained with DAPI (Cyan). Nuclear staining was observed in glandular cells of human colon section (A) and in proliferative colon intestinal organoids (B).
Immunohistochemistry Anti-HOXB9: Cat. No. AV32639: Immunohistochemistry of HOXB9 in Human Lung tissue with HOXB9 antibody at 4-8 μg/mL.
Immunohistochemistry Anti-HOXB9: Cat. No. AV32639: Immunohistochemistry of HOXB9 in Human Lung tissue with HOXB9 antibody at 4-8 μg/mL.
Immunohistochemistry HOXB9 Antibody: Cat. No. AV32639: Immunohistochemistry analysis of HOXB9 in Human Lung with HOXB9 Antibody Antibody Concentration: 4.0-8.0 μg/mL. Cellular Data: Epithelial cells of renal tubule
Immunoblotting Cell Type: HepG2 (Cat. No. AV32639). Lanes 1. Antibody dilution (concentration) 1.0-2.0 μg/mL in cell type HepG2

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 28 kDa
NCBI accession no. NP_076922 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, bovine, horse, pig, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P17482 
Application: Rabbit Anti-HOXB9 antibody has been used to detect Hoxb9 in bovine in embryos using whole-mount immunofluorescence and western blot techniques. The antibody has also been used at a dilution of 1:50 for immunohistochemical analysis in papillary thyroid carcinomas.
Biochem/physiol Actions: HOXB9 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. HOXB9 is one of several homeobox HOXB genes located in a cluster on chromosome 17. The exact role of this gene has yet to be determined.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: HOXB9 is a homeobox transcription factor that regulates cell growth and differentiation. HOXB9 is expressed throughout early bovine embryogenesis and has been implicated in thyroid cancer.
Rabbit Anti-HOXB9 antibody recognizes human, mouse, rat, bovine, and canine HOXB9.
Immunogen: Synthetic peptide directed towards the N terminal region of human HOXB9
Other Notes: Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top