Advanced Search



Anti-MyBL1 antibody produced in rabbit

SIGMA/AV32707 - IgG fraction of antiserum

Synonym: Anti-A-MYB; Anti-AMYB; Anti-MGC120059; Anti-MGC120061; Anti-v-Myb myeloblastosis viral oncogene homolog (avian)-like 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32707-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunohistochemistry Anti-MYBL1: Cat. No. AV32707: Immunohistochemistry of MYBL1 in Human Kidney tissue with MYBL1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV32707). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type Jurkat

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 49 kDa
NCBI accession no. NP_001073885 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, mouse, horse, dog, rat, human, guinea pig, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P10243 
Application: Rabbit Anti-MyBL1 antibody can be used for IHC (4-8μg/ml) and western blot (2.5μg/ml) applications.
Application: Rabbit polyclonal anti-MyBL1 antibody is used to tag v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 in spermatocyte development.
Biochem/physiol Actions: MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5′-YAAC[GT]G-3′. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Rabbit polyclonal anti-MyBL1 antibody reacts with chicken, canine, human, mouse, and rat v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 transcription factors.
General description: v-Myb myeloblastosis viral oncogene homolog (avian)-like 1 (MyBL1) which is expressed predominantly as a tissue-specific transcription factor in spermatocytes and breast epithelial cells is a male-specific regulator of several crucial meiotic processes. MYBL1 is a master regulator of meiotic genes that are involved in multiple processes in spermatocytes, particularly those required for cell cycle progression through pachynema. MYBL1 directs germ cell-specific activation via the CRE site of certain genes.
Immunogen: Synthetic peptide directed towards the middle region of human MYBL1
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: PRTPTPFKNALAAQEKKYGPLKIVSQPLAFLEEDIREVLKEETGTDLFLK
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top