Advanced Search



Anti-ACSL1 (AB1) antibody produced in rabbit

SIGMA/AV32784 - affinity isolated antibody

Synonym: Anti-ACS1; Anti-Acyl-CoA synthetase long-chain family member 1; Anti-FACL1; Anti-FACL2; Anti-LACS; Anti-LACS1; Anti-LACS2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32784-100UL 100 µL
$493.00
1/EA
Add To Favorites
Immunohistochemistry Anti-ACSL1 (ab1): Cat. No. AV32784: Immunohistochemistry of ACSL1 in Human Kidney tissue with ACSL1 antibody at 4-8 μg/mL.
Immunohistochemistry Anti-ACSL1 (ab1): Cat. No. AV32784: Immunohistochemistry of ACSL1 in heart; liver; pancreas; brain tissue with ACSL1 antibody at 5.0 μg/mL.
Immunohistochemistry ACSL1 Antibody: Cat. No. AV32784: Immunohistochemistry analysis of ACSL1 in Human Liver Tissue with ACSL1 Antibody 1.0 μg/mL. Observed Staining: Cytoplasm in hepatocytes
Immunoblotting Cell Type: HeLa (Cat. No. AV32784). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type HeLa

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 78 kDa
NCBI accession no. NP_001986 
Quality Level 100 
shipped in wet ice
species reactivity human, mouse, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P33121 
Application: Rabbit Anti-ACSL1 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml.
Biochem/physiol Actions: ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: ACSL1 is an isozyme that belongs to the long-chain fatty-acid-coenzyme A ligase family. This enzyme converts free long-chain fatty acids into fatty acyl-CoA esters. Thus, it regulates lipid synthesis and fatty acid breakdown. Studies in bovine mammary glands have reported that ACSL1 modulates the channelling of fatty acids towards milk fat formation.
Rabbit Anti-ACSL1 (AB1) antibody recognizes pig, bovine, zebrafish, human, mouse, rat, and canine ACSL1.
Immunogen: Synthetic peptide directed towards the C terminal region of human ACSL1
Other Notes: Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top