Advanced Search



Anti-PCK1 (AB2) antibody produced in rabbit

SIGMA/AV32801 - affinity isolated antibody

Synonym: Anti-MGC22652; Anti-PEPCK-C; Anti-PEPCK1; Anti-PEPCKC; Anti-Phosphoenolpyruvate carboxykinase 1 (soluble)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV32801-100UL 100 µL
$500.00
1/EA
Add To Favorites
Immunofluorescence Tissue: kidney (Cat. No. AV32801). Specification 1. Antibody dilution (concentration) 4-8 μg/mL
Immunoblotting Cell Type: Jurkat (Cat. No. AV32801). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type Jurkat
Western Blotting Western Blot of PCK1 in Human MCF7 with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in Human Fetal Heart with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in Human Fetal Lung with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in Human Fetal Liver with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in Human Fetal Muscle with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in Human Adult Placenta with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in pig serum with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in pig serum protein with PCK1 antibody at 1 μg/mL
Western Blotting Western Blot of PCK1 in Human MCF7 Whole Cell with PCK1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 69 kDa
NCBI accession no. NP_002582 
Quality Level 100 
shipped in wet ice
species reactivity human, mouse, horse, dog, rat, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P35558 
Application: Rabbit Anti-PCK1 (AB2) antibody can be used for western blot applications at a concentration of 1.25μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Biochem/physiol Actions: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.This gene is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of this gene can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet. Defects in this gene are a cause of cytosolic phosphoenolpyruvate carboxykinase deficiency. A mitochondrial isozyme of the encoded protein also has been characterized. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: PCK1 is a cytosolic enzyme that catalyzes the synthesis of phosphoenolpyruvate from oxaloacetate. Studies in mice have reported that Pck1 may have implications in diabetes and obesity-related disorders.
Rabbit Anti-PCK1 (AB1) antibody recognizes bovine, chicken, pig, human, mouse, and rat PCK1.
Immunogen: Synthetic peptide directed towards the middle region of human PCK1
Other Notes: Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top