Advanced Search



Anti-MMP9 antibody produced in rabbit

SIGMA/AV33090 - IgG fraction of antiserum

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV33090-100UL 100 µL
$383.00
1/EA
Add To Favorites
Immunohistochemistry Anti-MMP9: Cat. No. AV33090: Immunohistochemistry of MMP9 in Rat and Mouse tissue with MMP9 antibody at 2-15 μg/mL.
Immunoblotting Cell Type: K562 (Cat. No. AV33090). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type K562
Western Blotting Western Blot of MMP9 in Human Fetal Lung with MMP9 antibody at 1 μg/mL
Western Blotting Western Blot of MMP9 in Human Ovary Tumor with MMP9 antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 78 kDa
NCBI accession no. NP_004985 
Quality Level 100 
shipped in wet ice
species reactivity human, dog, mouse, guinea pig, horse, bovine, sheep, rat, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P14780 
Application: Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper) 
Application: Rabbit polyclonal anti-MMP9 antibody is used to tag matrix metalloproteinase-9/gelatinase B for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of matrix metalloproteinase-9/gelatinase B in processe such as synaptic plasticity.
Biochem/physiol Actions: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP′s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by MMP9 degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Matrix metalloproteinase-9/gelatinase B (MMP-9), a member of the matrix metalloproteinase (MMP) family, is involved in the breakdown of extracellular matrix giving it a role in normal physiological processes such as embryonic development, tissue remodeling, wound repair, vascularization and inflammatory response. MMP-9 is involved in synaptic plasticity. MMP-9 functions in modulating hippocampal synaptic physiology and plasticity.
Immunogen: Synthetic peptide directed towards the N terminal region of human MMP9
Other Notes: Synthetic peptide located within the following region: VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top