Advanced Search



Anti-RPS16 (AB1) antibody produced in rabbit

SIGMA/AV33535 - IgG fraction of antiserum

Synonym: Anti-Ribosomal protein S16

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV33535-100UL 100 µL
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunohistochemistry Anti-RPS16 (ab1): Cat. No. AV33535: Immunohistochemistry of RPS16 in Human Lung tissue with RPS16 antibody at 4-8 μg/mL.
Immunohistochemistry RPS16 Antibody: Cat. No. AV33535: Immunohistochemistry analysis of RPS16 in Human Lung with RPS16 Antibody Antibody Concentration: 4.0-8.0 μg/mL. Cellular Data: Epithelial cells of renal tubule
Immunoblotting Cell Type: Jurkat (Cat. No. AV33535). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type Jurkat
Immunoblotting RPS16: Cat. No. AV33535: Western blot analysis of RPS16 in Human Jurkat cell lysates with RPS16 antibody at 2.5 μg/mL .

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 16 kDa
NCBI accession no. NP_001011 
shipped in wet ice
species reactivity mouse, rat, guinea pig, horse, rabbit, bovine, human, dog
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P62249 
Biochem/physiol Actions: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS16 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the N terminal region of human RPS16
Other Notes: Synthetic peptide located within the following region: SKGPLQSVQVFGRKKTATAVAHCKRGNGLIKVNGRPLEMIEPRTLQYKLL
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top