Advanced Search



Anti-SIAH1 (AB1) antibody produced in rabbit

SIGMA/AV34163 - IgG fraction of antiserum

Synonym: Anti-Seven in absentia homolog 1 (Drosophila)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV34163-100UL 100 µL
$469.00
1/EA
Add To Favorites
Immunohistochemistry SIAH1 Antibody: Cat. No. AV34163: Immunohistochemistry analysis of SIAH1 in Human Heart with SIAH1 Antibody Antibody Concentration: 4.0-8.0 μg/mL. Cellular Data: Epithelial cells of renal tubule
Immunoblotting Cell Type: Jurkat (Cat. No. AV34163). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type Jurkat
Western Blotting Western Blot of SIAH1 in Human HEK293T with SIAH1 antibody at 1 μg/mL
Western Blotting Western Blot of SIAH1 in Mouse Liver with SIAH1 antibody at 1 μg/mL

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 35 kDa
NCBI accession no. NP_001006611 
Quality Level 100 
shipped in wet ice
species reactivity guinea pig, bovine, mouse, rabbit, rat, dog, human, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q8IUQ4-2  
Application: Rabbit Anti-SIAH1 (AB1) antibody can be used for western blot applications at 1.25 μg/ml.
Biochem/physiol Actions: SIAH1 is a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in the development of certain forms of Parkinson′s disease, the regulation of the cellular response to hypoxia and induction of apoptosis. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: SIAH1 is an E3 ligase that regulates protein ubiquitination and proteasome-mediated degradation. Studies have reported that the N-terminal RING domain regulates proteolysis, whereas the C-terminal sequences modulate target protein binding activities. It has also been implicated in p53 response-mediated degradation of β-catenin.
Rabbit Anti-SIAH1 (AB1) antibody recognizes bovine, human, mouse, rat, canine, and zebrafish SIAH1.
Immunogen: Synthetic peptide directed towards the N terminal region of human SIAH1
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top