Advanced Search



Anti-TFB2M (AB1) antibody produced in rabbit

SIGMA/AV34471 - IgG fraction of antiserum

Synonym: Anti-FLJ22661; Anti-FLJ23182; Anti-Hkp1; Anti-Transcription factor B2, mitochondrial

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV34471-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunohistochemistry Anti-TFB2M (ab1): Cat. No. AV34471: Immunohistochemistry of TFB2M in Human Intestine tissue with TFB2M antibody at 4-8 μg/mL.
Immunoblotting Cell Type: transfected 293T (Cat. No. AV34471). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type transfected 293T

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 45 kDa
NCBI accession no. NP_071761 
Quality Level 100 
shipped in wet ice
species reactivity horse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9H5Q4 
Application: Rabbit Anti-TFB2M (AB1) antibody is suitable for western blot (1.25 μg/ml) and IHC (4-8 μg/ml) applications.
Biochem/physiol Actions: TFB2M is a S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. It is also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. It stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, it activates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: TFB2M is a mitochondrial transcription factor that regulates the expression of SERCA2 gene in rat cardiomyocytes. It is also known to induce the transcription of human mtDNA.
Rabbit Anti-TFB2M (AB1) antibody recognizes human and rat TFB2M.
Immunogen: Synthetic peptide directed towards the N terminal region of human TFB2M
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ECNPGPGILTQALLEAGAKVVALESDKTFIPHLESLGKNLDGKLRVIHCD
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top