Advanced Search



Anti-E2F7 antibody produced in rabbit

SIGMA/AV37583 - affinity isolated antibody

Synonym: Anti-A630014C11Rik; Anti-D10Ertd739e; Anti-E2F transcription factor 7

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV37583-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Anti-E2F7: Cat. No. AV37583: Immunohistochemistry of E2f7 in Mouse stomach tissue with E2f7 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: SP2/0 (Cat. No. AV37583). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type SP2/0
Immunoblotting E2F7 Antibody: Cat. No. AV37583: Western Blot analysis of E2F7 in Mouse stomach cell lysates with E2F7 Antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 99 kDa
NCBI accession no. NP_848724 
Quality Level 100 
shipped in wet ice
species reactivity mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q6S7F2 
Application: Anti-E2F7 polyclonal antibody is used to tag E2F transcription factor 7 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 7 in the regulation of cell proliferation, especially at the level of G(1)/S gene activity during S-phase progression.
Biochem/physiol Actions: E2F7 is a E2F family member. It can block the E2F-dependent activation of a subset of E2F target genes as well as mitigate cellular proliferation of mouse embryo fibroblasts
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 7 (E2F7) which is highly expressed during mid to late S-phase binds to the promoter regions of and represses G(1)/S-regulated genes thus promoting the downswing of oscillating G(1)/S genes during S-phase progression.

The previously assigned protein identifier Q8BSQ3 has been merged into Q6S7F2. Full details can be found on the UniProt database.
Immunogen: Synthetic peptide directed towards the N terminal region of mouse E2f7
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MEVNCLTLKDLISPRQTRLDFAIEDAENAQKENIFVDRSRMTPKTPMKNE
Specificity: Anti-E2F7 polyclonal antibody reacts with human, rat, canine, bovine, and mouse E2F transcription factor 7 proteins.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top