Advanced Search



Anti-KCNAB2 (AB1) antibody produced in rabbit

SIGMA/AV37678 - affinity isolated antibody

Synonym: Anti-Potassium voltage-gated channel, shaker-related subfamily, β member 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV37678-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemistry of KCNAB2 in Human Kidney with KCNAB2 antibody at 4-8 μg/mL
Immunohistochemistry Immunohistochemistry of KCNAB2 in Mouse Brain with KCNAB2 antibody at 4-8 μg/mL
Immunoblotting Cell Type: fetal thymus (Cat. No. AV37678). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type fetal thymus
Western Blotting Western Blot of KCNAB2 in Human Jurkat with KCNAB2 antibody at 1 μg/mL
Western Blotting Western Blot of KCNAB2 in Human HepG2 with KCNAB2 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 40 kDa
NCBI accession no. NP_742128 
Quality Level 100 
shipped in wet ice
species reactivity guinea pig, dog, rat, bovine, horse, human, mouse, rabbit
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q13303 
Biochem/physiol Actions: Potassium voltage-gated channel subfamily A regulatory β subunit 2 (KCNAB2) gene is involved in neuroendocrine conditions KCNAB2 serves as a candidate gene for epilepsy. A cardiac arrhythmia disorder, called Brugada syndrome occurs due to the gain-of-function mutation in KCNAB2 gene. Voltage-gated potassium (Kv) channels play a key role in modulating the contraction of smooth muscle, secretion of insulin, the release of neurotransmitters, and excitability of the neuron. It also participates in heart rate, epithelial electrolyte transport, and cell volume.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Potassium voltage-gated channel subfamily A regulatory beta subunit 2 (KCNAB2), an ion channel gene, codes for a voltage?gated K+ channel β?subunit protein, Kvβ2. This gene is located on human chromosome 1p36. Kvβ2 is expressed ubiquitously in the human heart. It belongs to the aldo?keto reductase superfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-α subunits.
Immunogen: Synthetic peptide directed towards the middle region of human KCNAB2
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV
RIDADR NONH for all modes of transport
WGK Germany WGK 2
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top