Advanced Search



Anti-E2F3 antibody produced in rabbit

SIGMA/AV38089 - affinity isolated antibody

Synonym: Anti-E2F transcription factor 3

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV38089-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Cell Type: fetal thymus (Cat. No. AV38089). Lanes 1. Antibody dilution (concentration) 0.25 μg/mL in cell type fetal thymus
Western Blotting Western Blot of E2F3 in Human Ovary Tumor with E2F3 antibody at 1 μg/mL
Western Blotting Western Blot of E2F3 in Human Lung Tumor with E2F3 antibody at 1 μg/mL
Western Blotting Western Blot of E2F3 in Mouse Small Intestine with E2F3 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 49 kDa
NCBI accession no. NP_001940 
Quality Level 100 
shipped in wet ice
species reactivity mouse, human, dog, guinea pig, rat, horse, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q68DT0  
Application: Anti-E2F3 polyclonal antibody is used to tag E2F transcription factor 3 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of E2F transcription factor 3 in the regulation of cell growth, differentiation and cell death and as an oncogene.
Biochem/physiol Actions: Anti-E2F3 polyclonal antibody reacts with canine, human, mouse, rat, and bovine E2F transcription factor 3 proteins.
Biochem/physiol Actions: E2F3 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. E2F3 binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: E2F transcription factors are key regulators of cell growth, differentiation and cell death. E2F transcription factor 3 (E2F3) can be induced by DNA damage through transcriptional and posttranslational mechanisms wherein it functions as a master regulator of DNA damage response. E2F3, a transcriptional effector that commits cells to enter and progress through S phase, is uniquely amplified in specific human tumours, such as prostate cancer, where its expression is inversely correlated with the survival of patients.
Immunogen: Synthetic peptide directed towards the C terminal region of human E2F3
Other Notes: Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 2
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top