Advanced Search



Anti-IRF1 (AB2) antibody produced in rabbit

SIGMA/AV38128 - affinity isolated antibody

Synonym: Anti-IRF-1; Anti-Interferon regulatory factor 1; Anti-MAR

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV38128-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunohistochemistry of IRF1 in Human liver tissue with IRF1 antibody at 4-8 μg/mL
Immunoblotting Cell Type: HepG2 (Cat. No. AV38128). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type HepG2
Western Blotting Western Blot of IRF1 in Rat Liver with IRF1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 37 kDa
NCBI accession no. NP_002189 
Quality Level 100 
shipped in wet ice
species reactivity sheep, rabbit, guinea pig, rat, dog, human, mouse, bovine, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P10914 
Application: Anti-IRF1 (AB2) polyclonal antibody is used to tag interferon regulatory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of interferon regulatory factor 1 in gene expression of proteins involve in the immune response, apoptosis, and tumor suppression.
Biochem/physiol Actions: IRF1 is interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppression.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Interferon regulatory factor 1 (IRF1) is a transcription factor and gene trans-activator that activates interferon-β and various other target gene expression to help regulate cell processes such as the immune response, apoptosis, and tumor suppression.
Immunogen: Synthetic peptide directed towards the N terminal region of human IRF1
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK
Specificity: Anti-IRF1 (AB2) polyclonal antibody reacts with chicken, pig, canine, bovine, human, mouse, and rat interferon regulatory factor 1 proteins.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top