Advanced Search



Anti-NR5A2 antibody produced in rabbit

SIGMA/AV38386 - IgG fraction of antiserum

Synonym: Anti-B1F; Anti-B1F2; Anti-CPF; Anti-FTF; Anti-FTZ-F1; Anti-FTZ-F1beta; Anti-LRH-1; Anti-Nuclear receptor subfamily 5, group A, member 2

MDL Number: MFCD07370495
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV38386-100UL 100 µL
$490.00
1/EA
Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV38386). Lanes 1. Antibody dilution (concentration) 2.5 μg/mL in cell type HepG2

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 61 kDa
NCBI accession no. NP_003813 
Quality Level 100 
shipped in wet ice
species reactivity human, sheep, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. O00482  
Application: Anti-NR5A2 polyclonal antibody is used to tag liver receptor homolog-1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of liver receptor homolog-1 in the regulation of bile acid biosynthesis, cholesterol transport and steroidogenesis.
Biochem/physiol Actions: Anti-NR5A2 polyclonal antibody reacts with human and bovine nuclear receptor subfamily 5, group A, member 2/ liver receptor homolog-1 proteins.
Biochem/physiol Actions: NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Nuclear receptor subfamily 5, group A, member 2 (NR5A2, BIF2, FTZ-F1β) is a transcription factor involved in cholesterol transport, bile acid homeostasis and steroidogenesis. Also known as liver receptor homolog-1, LRH-1 is expressed primarily in liver, intestine, exocrine pancreas, ovary and embryonic stem cells (ESC). LRH-1 regulates the expression of the key bile acid biosynthetic enzyme cholesterol 7α hydroxylase (Cyp7A1).
Immunogen: Synthetic peptide directed towards the N terminal region of human NR5A2
Other Notes: Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top