Advanced Search



Anti-NRF1 antibody produced in rabbit

SIGMA/AV38543 - IgG fraction of antiserum

Synonym: Anti-ALPHA-PAL; Anti-EWG; Anti-Nuclear respiratory factor 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV38543-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Anti-NRF1: Cat. No. AV38543: Immunohistochemistry of NRF1 in Human Lung tissue with NRF1 antibody at 16μg/mL.
Immunoblotting Cell Type: transfected 293T (Cat. No. AV38543). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type transfected 293T

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 56 kDa
NCBI accession no. NP_001035199 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q16656 
Application: Anti-NRF1 polyclonal antibody is used to tag nuclear respiratory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of nuclear respiratory factor 1 in respiratory and antioxidation processes and nuclear, mitochondrial biogenomic coordination.
Biochem/physiol Actions: Anti-NRF1 polyclonal antibody reacts with human nuclear respiratory factor 1.
Biochem/physiol Actions: NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth.This gene encodes a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Nuclear respiratory factor 1 (NRF1) is a transcription factor that activates cassettes of metabolic genes that regulate cellular respiratory and oxidative stress genes involved in heme biosynthesis, mitochondrial DNA transcription and replication and antioxidant enzymes. NRF1 and NRF2 function to mediate biogenomic coordination between nuclear and mitochondrial genomes.

The previously assigned protein identifier Q96AN2 has been merged into Q16656. Full details can be found on the UniProt database.
Immunogen: Synthetic peptide directed towards the C terminal region of human NRF1
Other Notes: Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top