Advanced Search



Anti-TARDBP (AB1) antibody produced in rabbit

SIGMA/AV38941 - IgG fraction of antiserum

Synonym: Anti-TAR DNA binding protein

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV38941-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunohistochemistry Anti-TARDBP (ab1): Cat. No. AV38941: Immunohistochemistry of TARDBP in Human Liver tissue with TARDBP antibody at 4-8 μg/mL.
Immunohistochemistry Anti-TARDBP (ab1): Cat. No. AV38941: Immunohistochemistry of TARDBP in Human Liver tissue with TARDBP antibody at 4-8 μg/mL.
Immunoblotting Cell Type: HepG2 (Cat. No. AV38941). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type HepG2

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 45 kDa
NCBI accession no. NP_031401 
Quality Level 100 
shipped in wet ice
species reactivity bovine, rat, guinea pig, human, dog, horse, mouse
storage temp. −20°C
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q13148 
Application: Anti-TARDBP (AB1) polyclonal antibody is used to tag TAR DNA binding protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of TAR DNA binding protein in the repression of gene expression and regulation of pre-mRNA splicing and translation.
Biochem/physiol Actions: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: TAR DNA binding protein (TARDBP) is a DNA and RNA binding transcription repressor and regulator of pre-mRNA splicing and translation. TARDBP binds to the regulatory element TAR found in the transcription initiation site of the HIV-1 gene Tat; consequently TARDBP is an active repressor of chromosomally integrated HIV-1 tat. TARDBP also regulates alternative splicing of CFTR and apo-II genes. A defective form of TARDBP is associated with amyotrophic lateral sclerosis (ALS).
Immunogen: Synthetic peptide directed towards the N terminal region of human TARDBP
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC
Specificity: Anti-TARDBP (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, chicken, and canine TAR DNA binding protein(s).
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top