Advanced Search



Anti-TRIM32 (AB2) antibody produced in rabbit

SIGMA/AV38966 - IgG fraction of antiserum

Synonym: Anti-BBS11; Anti-HT2A; Anti-LGMD2H; Anti-TATIP; Anti-Tripartite motif-containing 32

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV38966-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunohistochemistry Anti-TRIM32 (ab2): Cat. No. AV38966: Immunohistochemistry of TRIM32 in Human Muscle tissue with TRIM32 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: transfected 293T (Cat. No. AV38966). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type transfected 293T

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 72 kDa
NCBI accession no. NP_001093149 
Quality Level 100 
shipped in wet ice
species reactivity rat, bovine, human, rabbit, mouse, horse, dog, guinea pig
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q13049  
Application: Anti-TRIM32 (AB2) polyclonal antibody is used to tag tripartite motif-containing 32 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of tripartite motif-containing 32 in cell differentiation via miRNA regulation and ubiquitination of key regulatory proteins.
Biochem/physiol Actions: TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Tripartite motif-containing 32 (TRIM32, BBS11, HT2A, LGMD2H, TATIP) is an E3 ubiquitin ligase that ubiquitinates proteins such as c-Myc, dysbindin, actin, paisy, and abl-interactor 2 (ABI2). TRIM32 is involved in the regulation of miRNA activation and the induction of neuronal differentiation in brain regions such as the neocortex. TRIM32 regulates skeletal muscle stem cell differentiation
Immunogen: Synthetic peptide directed towards the C terminal region of human TRIM32
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY
Specificity: Anti-TRIM32 (AB2) polyclonal reacts with bovine, human, mouse, rat, zebrafish, and canine tripartite motif-containing 32 proteins.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top