Advanced Search



Anti-NR2F2 (AB1) antibody produced in rabbit

SIGMA/AV39466 - IgG fraction of antiserum

Synonym: Anti-Nuclear receptor subfamily 2, group F, member 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV39466-100UL 100 µL
$443.00
1/EA
Add To Favorites
Immunoblotting Cell Type: HepG2 (Cat. No. AV39466). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type HepG2

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 46 kDa
NCBI accession no. NP_066285 
Quality Level 100 
shipped in wet ice
species reactivity dog, rabbit, human, guinea pig, sheep, horse, rat, mouse, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P24468  
Application: Anti-NR2F2 (AB1) polyclonal antibody is used to tag COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of COUP transcription factor 2 in cell signaling pathways such as the glucagon-like peptide 1 (GLP-1) signaling cascade.
Biochem/physiol Actions: NR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: COUP transcription factor 2/nuclear receptor subfamily 2, group F, member 2 (COUP-TFII, NR2F2) is a nuclear receptor that regulates amygdale patterning via expression of neurophilin.COUP-TFII is a component of the glucagon-like peptide 1 (GLP-1) signaling cascade that stimulates neonatal β-cell number. COUP-TFII is required for GLP-1 activation of the β-catenin-dependent pathway.
Immunogen: Synthetic peptide directed towards the C terminal region of human NR2F2
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
Specificity: Anti-NR2F2 (AB1) polyclonal antibody reacts with chicken, bovine, pig, zebrafish, human, mouse, rat, and canine COUP transcription factor 2 proteins.
RIDADR NONH for all modes of transport
WGK Germany WGK 1
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top