Advanced Search



Anti-MAX antibody produced in rabbit

SIGMA/AV39844 - affinity isolated antibody

Synonym: Anti-MGC10775; Anti-MGC11225; Anti-MGC18164; Anti-MGC34679; Anti-MGC36767; Anti-MyC associated factor X; Anti-Orf1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV39844-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Cell Type: fetal lung (Cat. No. AV39844). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type fetal lung

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 17 kDa
NCBI accession no. NP_660087 
Quality Level 100 
shipped in wet ice
species reactivity human, pig, mouse, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P61244 
Application: Anti-MAX polyclonal antibody is used to tag MyC associated factor X protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of myC associated factor X in the regulation of RNA transcription especially in association with myc or mad transcription factors.
Biochem/physiol Actions: Anti-MAX polyclonal antibody reacts with human, mouse, rat, chicken, canine, and zebrafish myC associated factor X proteins.
Biochem/physiol Actions: MAX is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation.The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Multiple alternatively spliced transcript variants have been described for this gene but the full length nature for some of them is unknown.The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature for some of them is unknown.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: MyC associated factor X (MAX), Myc and Mad are basic helix-loop-helix leucine zipper transcription factors that bind to a specific hexanucleotide element of DNA, the E-box (CACGTG). Myc and Mad form heterodimers with Max to become active regulators of transcription. Myc:Max and Mad:Max heterodimers form higher order complexes that regulate a wide range of cell processes at the level of transcription. Myc:Max and Mad:Max dimerizations are regulatory control points for many myc and mad mediated cell processes.
Immunogen: Synthetic peptide directed towards the n terminal region of human MAX
Other Notes: Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 2
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top