Advanced Search



Anti-EHF antibody produced in rabbit

SIGMA/AV40136 - affinity isolated antibody

Synonym: Anti-9030625L19Rik; Anti-AU019492; Anti-Ets homologous factor

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40136-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-EHF: Cat. No. AV40136: Immunohistochemistry of Ehf in Human Kidney tissue with Ehf antibody at 4-8 μg/mL.
Immunoblotting Cell Type: mouse prostate (Cat. No. AV40136). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type mouse prostate

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 33 kDa
NCBI accession no. NP_031940 
Quality Level 100 
shipped in wet ice
species reactivity rat, human, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q9NZC4 
Application: Anti-EHF polyclonal antibody is used to tag ETS homologous factor proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of ETS homologous factor as a potential prognostic marker for carcinomas such as ovarian carcinoma cancer and to study gene regulation during carcinogenesis.
Biochem/physiol Actions: Anti-EHF polyclonal antibody reacts with human, mouse, rat, chicken, bovine, and canine ETS homologous factor proteins.
Biochem/physiol Actions: Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: ETS transcription factors share a conserved DNA-binding "ETS" domain and include several oncoproteins that induce tumorigenesis when overexpressed. ETS homologous factor (EHF) has been found in kidney, lung and somatotroph tumors. ETS, potentially a tumor suppressor and senescence modulator, is most highly expressed in the organs known to form carcinomas upon 11p12 deletion. ETS may be a prognostic marker of carcinomas such as ovarian carcinoma.
Immunogen: Synthetic peptide directed towards the N terminal region of mouse Ehf
Other Notes: Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top