Advanced Search



Anti-HOMER1 (AB2) antibody produced in rabbit

SIGMA/AV40182 - affinity isolated antibody

Synonym: Anti-HOMER1A; Anti-HOMER1B; Anti-HOMER1C; Anti-Homer homolog 1 (Drosophila); Anti-SYN47; Anti-Ves-1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40182-100UL 100 µL
$524.00
1/EA
Add To Favorites
Immunoblotting Cell Type: transfected 293T (Cat. No. AV40182). Lanes 1. Antibody dilution (concentration) 0.0156 μg/mL in cell type transfected 293T
Western Blotting Western Blot of HOMER1 in Mouse Brain with HOMER1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 39 kDa
NCBI accession no. NP_004263 
Quality Level 100 
shipped in wet ice
species reactivity pig, rabbit, human, rat, dog, horse, bovine, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. Q86YM7 
Application: Anti-HOMER1 (AB2) polclonal antibody is used to tag the homer 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of homer 1 as a modulator of calcium transport and signaling involved in apoptosis, body movement and various cellular processes.
Biochem/physiol Actions: HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Homer proteins are cytoplasmic adaptor proteins that contain the Ena/VASP homology 1 domain that binds to the PPXXF sequence motifs found in Ca2+ handling proteins such as IP3 receptors, transient receptor potential canonical (TRPC) channels and ryanodine receptor (RyR) Ca2+ release channels. HOMER1, a calcium signaling complex modulator, is involved in the opening and closing of TRPC channels such as the endoplasmic reticulum store-operated Ca2+ -influx channels (SOCs). Homer1 plays a critical role in determining the apoptotic susceptibility to TRAIL, an apoptotic cell death-inducing ligand that belongs to a TNF superfamily.
Immunogen: Synthetic peptide directed towards the N terminal region of human HOMER1
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
Specificity: Anti-HOMER1 (AB2) polclonal antibody reacts with canine, human, mouse, rat, and bovine homer 1 adaptor proteins.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top