Advanced Search



Anti-RPLP0 (AB1) antibody produced in rabbit

SIGMA/AV40221 - affinity isolated antibody

Synonym: Anti-L10E; Anti-MGC111226; Anti-MGC88175; Anti-P0; Anti-PRLP0; Anti-RPP0; Anti-Ribosomal protein, large, P0

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40221-100UL 100 µL
$541.00
1/EA
Add To Favorites
Immunohistochemistry RPLP0 Antibody: Cat. No. AV40221: Immunohistochemistry analysis of RPLP0 in Human Bronchial Epithelial Tissue with RPLP0 Antibody 5.0 μg/mL. Observed Staining: Cytoplasmic
Immunoblotting Cell Type: HepG2 (Cat. No. AV40221). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type HepG2

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 34 kDa
NCBI accession no. NP_000993 
Quality Level 100 
shipped in wet ice
species reactivity mouse, guinea pig, bovine, human, rabbit, rat, dog, horse
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P05388 
Application: Anti-RPLP0 (AB1) polyclonal antibody is used to tag ribosomal protein, large, P0 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of ribosomal protein, large, P0 in ribosome assembly and function.
Biochem/physiol Actions: Anti-RPLP0 (AB1) polyclonal antibody reacts with zebrafish, canine, chicken, human, mouse, and rat ribosomal protein, large, P0 proteins.
Biochem/physiol Actions: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins. It is a neutral phosphoprotein with a C-terminal end that is nearly identical to the C-terminal ends of the acidic ribosomal phosphoproteins P1 and P2. The P0 protein can interact with P1 and P2 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Ribosomal protein, large, P0 (RPLPO, L10E), a functional equivalent of E. cole L10 ribosomal protein, is an acidic phosphoprotein component of the 60S subunit of ribosomes. RPLPO can interact with PRLP1 and RPLP2 dimers to form a pentameric complex.
Immunogen: Synthetic peptide directed towards the N terminal region of human RPLP0
Other Notes: Synthetic peptide located within the following region: TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top