Advanced Search



Anti-EXOSC10 antibody produced in rabbit

SIGMA/AV40225 - IgG fraction of antiserum

Synonym: Anti-Exosome component 10

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40225-100UL 100 µL
$457.00
1/EA
Add To Favorites
Immunohistochemistry Anti-EXOSC10: Cat. No. AV40225: Immunohistochemistry of EXOSC10 in Human Intestine tissue with EXOSC10 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: Jurkat (Cat. No. AV40225). Lanes 1. Antibody dilution (concentration) 5.0 μg/mL in cell type Jurkat

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 97 kDa
NCBI accession no. NP_002676 
Quality Level 100 
shipped in wet ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. Q01780  
Application: Anti-EXOSC10 polyclonal antibody is used to tag polymyositis/scleroderma autoantigen 2, 100kDa for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) in the function of specific exosomes.
Biochem/physiol Actions: Anti-EXOSC10 polyclonal antibody reacts with human, mouse, rat, and bovine polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) proteins.
Biochem/physiol Actions: EXOSC10 contains 1 HRDC domain and 1 3′-5′ exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Exosome complex (RNAse complex), a complex of 3′ -→ 5′ exoribonucleases, is a multi-protein complex that degrades various types of ribonucleic acids (RNA). Exosome component 10 (EXOSC10, PMSCL2, "polymyositis/scleroderma autoantigen 2, 100kDa) is an exoribonuclease that shares sequence similarity to budding yeast Rrp6 and is proposed to catalyze 3′-to-5′ exoribonuclease activity on a variety of nuclear transcripts including ribosomal RNA subunits, RNA that has been poly-adenylated by TRAMP, as well as other nuclear RNA transcripts destined for processing and/or destruction.
Immunogen: Synthetic peptide directed towards the C terminal region of human EXOSC10
Other Notes: Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top