Advanced Search



Anti-CUGBP2 antibody produced in rabbit

SIGMA/AV40324 - affinity isolated antibody

Synonym: Anti-BRUNOL3; Anti-CUG triplet repeat, RNA binding protein 2; Anti-ETR-3; Anti-NAPOR

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40324-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Cell Type: placenta (Cat. No. AV40324). Lanes 1. Antibody dilution (concentration) 1 μg/mL in cell type placenta
Western Blotting Western Blot of CUGBP2 in Human Jurkat with CUGBP2 antibody at 1 μg/mL
Western Blotting Western Blot of CUGBP2 in Human 721_B with CUGBP2 antibody at 1 μg/mL
Western Blotting Western Blot of CUGBP2 in Human Fetal Heart with CUGBP2 antibody at 1 μg/mL
Western Blotting Western Blot of CUGBP2 in Human Fetal Liver with CUGBP2 antibody at 1 μg/mL
Western Blotting Western Blot of CUGBP2 in Human Fetal Lung with CUGBP2 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 56 kDa
NCBI accession no. NP_006552 
Quality Level 100 
shipped in wet ice
species reactivity rabbit, mouse, dog, horse, rat, guinea pig, human, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. O95319 
Application: Anti-CUGBP2 polyclonal antibody is used to tag RNA binding protein 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of RNA binding protein 2 in the regulation of posttranslational gene transcription in response to gentotoxic injury.
Biochem/physiol Actions: Anti-CUGBP2 polyclonal antibody reacts with chicken, zebrafish, bovine, human, mouse, rat, and canine RNA binding protein 2 proteins.
Biochem/physiol Actions: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: CUGBP2 (ETR-3/NAPOR/BRUNOL3) is an RNA-binding protein, posttranscriptional controller of gene expression, that regulates key cellular responses such as apoptosis by binding to AU-rich sequences in the mRNA of important genes such as COX-2 and VEGF. CUGBP2 is a critical regulator of the apoptotic response to genotoxic injury in breast cancer cells and mitotic catastrophe response.
Immunogen: Synthetic peptide directed towards the N terminal region of human CELF2
Other Notes: Synthetic peptide located within the following region: NIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSP
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top