Advanced Search



Anti-CSH1 antibody produced in rabbit

SIGMA/AV40350 - IgG fraction of antiserum

Synonym: Anti-Chorionic somatomammotropin hormone 1 (placental lactogen)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40350-100UL 100 µL
$490.00
1/EA
Add To Favorites
Immunohistochemistry Anti-CSH1: Cat. No. AV40350: Immunohistochemistry of CSH1 in Human Stomach tissue with CSH1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: placenta (Cat. No. AV40350). Lanes 1. Antibody dilution (concentration) 1.25 μg/mL in cell type placenta

 

antibody form IgG fraction of antiserum
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 24 kDa
NCBI accession no. NP_066271 
Quality Level 100 
shipped in wet ice
species reactivity mouse, human, rabbit, guinea pig, dog, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P01243  
Biochem/physiol Actions: CSH1 is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: Synthetic peptide directed towards the middle region of human CSH1
Other Notes: Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top