Advanced Search



Anti-ACO1 antibody produced in rabbit

SIGMA/AV40390 - affinity isolated antibody

Synonym: Anti-Aconitase 1, soluble

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40390-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunohistochemistry Anti-ACO1: Cat. No. AV40390: Immunohistochemistry of ACO1 in Human Muscle tissue with ACO1 antibody at 4-8 μg/mL.
Immunoblotting Cell Type: fetal kidney (Cat. No. AV40390). Lanes 1. Antibody dilution (concentration) 0.5 μg/mL in cell type fetal kidney
Immunoblotting ACO1: Cat. No. AV40390: Western blot analysis of ACO1 in HePG2 cell lysates with ACO1 antibody at 1.0 μg/mL.

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 98 kDa
NCBI accession no. NP_002188 
Quality Level 100 
shipped in wet ice
species reactivity pig, rat, human, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry: suitable
  western blot: suitable
UniProt accession no. P28271 
Application: Anti-Aconitase-1 antibody is a rabbit IgG polyclonal antibody used to tag Aconitase-1 protein(s) for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques.
Biochem/physiol Actions: ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.Aconitase 1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). IREs are stem-loop structures found in the 5′ UTR of ferritin mRNA, and in the 3′ UTR of transferrin receptor mRNA. The iron-induced binding to the IRE results in repression of translation of ferritin mRNA, and inhibition of degradation of the otherwise rapidly degrading transferrin receptor mRNA. Thus, IREB1 plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.
Biochem/physiol Actions: Anti-Aconitase-1 antibody recognizes human aconitase-1.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Aconitase-1 is a soluble/cytoplasmin, non-mitochondrial enzyme that catalyzes the stereo-specific isomerization of citrate to isocitrate.
Immunogen: Synthetic peptide directed towards the N terminal region of human ACO1
Other Notes: Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top