Advanced Search



Anti-PTBP1 antibody produced in rabbit

SIGMA/AV40421 - affinity isolated antibody

Synonym: Anti-HNRNPI; Anti-HNRPI; Anti-MGC10830; Anti-MGC8461; Anti-PTB; Anti-PTB-1; Anti-PTB-T; Anti-Polypyrimidine tract binding protein 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-AV40421-100UL 100 µL
$580.00
1/EA
Add To Favorites
Immunoblotting Cell Type: Daudi (Cat. No. AV40421). Lanes 1. Antibody dilution (concentration) 1.0 μg/mL in cell type Daudi
Western Blotting Western Blot of PTBP1 in Human HepG2 with PTBP1 antibody at 1 μg/mL

 

antibody form affinity isolated antibody
antibody product type primary antibodies
biological source rabbit
clone polyclonal
concentration 0.5 mg - 1 mg/mL
conjugate unconjugated
form buffered aqueous solution
mol wt 58 kDa
NCBI accession no. NP_114367 
Quality Level 100 
shipped in wet ice
species reactivity rat, human, horse, guinea pig, mouse, bovine
storage temp. −20°C
target post-translational modification unmodified
technique(s) western blot: suitable
UniProt accession no. P26599  
Biochem/physiol Actions: Polypyrimidine tract-binding protein 1 (PTBP1) plays a key role in T cell activation, spermatogenesis, and splicing. It is involved in the differentiation and development of neuronal cells, growth of embryos and erythrocytes. PTBP1 also participates in apoptosis, glycolysis, migration, metastasis, proliferation, and carcinogenesis due to its role in cancer as a splicing factor. This protein plays a major role in neurodegenerative diseases, cardiovascular diseases, colon cancer, colorectal cancer, breast cancer, glioma, and glioblastoma.
Biochem/physiol Actions: The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. PTBP1 protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. Alternatively spliced transcript variants encoding different isoforms have been described.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Polypyrimidine tract-binding protein 1 (PTBP1) is a member of the ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs) subfamily. It has an N-terminal nuclear shuttling domain and four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. PTBP1 is mostly expressed in all cell types. The PTBP1 gene is mapped on human chromosome 19p13.3.
Immunogen: Synthetic peptide directed towards the N terminal region of human PTBP1
Other Notes: Synthetic peptide located within the following region: RGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHI
Physical form: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
RIDADR NONH for all modes of transport
WGK Germany WGK 3
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top